NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2232_1051879

Scaffold GOS2232_1051879


Overview

Basic Information
Taxon OID3300001958 Open in IMG/M
Scaffold IDGOS2232_1051879 Open in IMG/M
Source Dataset NameMarine microbial communities from Gulf of Mexico, USA - GS016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1286
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameGulf of Mexico, USA
CoordinatesLat. (o)24.174723Long. (o)-84.344444Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037767Metagenome167Y

Sequences

Protein IDFamilyRBSSequence
GOS2232_10518793F037767N/AADGSGDYAKRRCVATNSGWVFTPGQPNSGSDNSAAQPEVIECHRRLKDTIGVPTGNQVSIGTSSAKTTFYPDGDTFTGEASSDLGDVVAYVYFNEAVNVTGTPQLQLNQATALGSNFGTIMDYNASFSDESNGIVAFALPAGEDTRTSNVTNNTLGLITSSTISLNSGGIDKMTGDRIILEDVIASYSDNDTEAGIVLENEFGHLLEEAG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.