NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2250_1034273

Scaffold GOS2250_1034273


Overview

Basic Information
Taxon OID3300001957 Open in IMG/M
Scaffold IDGOS2250_1034273 Open in IMG/M
Source Dataset NameMarine microbial communities from Wolf Island, Equador - GS035
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1515
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameWolf Island, Equador
CoordinatesLat. (o)1.3891667Long. (o)-91.81695Alt. (m)Depth (m)1.7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029237Metagenome189Y

Sequences

Protein IDFamilyRBSSequence
GOS2250_10342732F029237AGGAGGMTNPKFGDVVDSNFIYSNEQRKKRKFGDSDIQVEGNPATYHAGDVVHLPYEAGETSTIEAIGLAWGAFASGVEPAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.