Scaffold GOS2250_1004223

Overview

Basic Information

• Taxon OID: 3300001957
• Scaffold ID: GOS2250_1004223
• Source Dataset Name: Marine microbial communities from Wolf Island, Equador - GS035
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1365
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Wolf Island, Equador
• Coordinates
  • Lat. (^o): 1.3891667
  • Long. (^o): -91.81695
  • Depth (m): 1.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088730	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2250_10042232	F088730	AGG	MIKRHNRQRNTPYLMPIKEDITRFYMKLKSKVMFYGWQIRSKYKK*