Scaffold GOS2266_1046765

Overview

Basic Information

• Taxon OID: 3300001956
• Scaffold ID: GOS2266_1046765
• Source Dataset Name: Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1728
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Rangirora Atoll, Polynesia Archipelagos
• Coordinates
  • Lat. (^o): -15.143611
  • Long. (^o): -147.435
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006348	Metagenome / Metatranscriptome	375	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2266_10467655	F006348	GGAGG	MNKFYIVEKIGFDTKFKTDDEIKELQWKSDNGLGVWSSEGKTEDERISKLFDKVQDYMGVYLTELSYCNNRPHPLTAFK*