Scaffold GOS2237_1031995

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2237_1031995

Scaffold GOS2237_1031995

Overview

Basic Information
Taxon OID	3300001955 Open in IMG/M
Scaffold ID	GOS2237_1031995 Open in IMG/M
Source Dataset Name	Marine microbial communities from Gulf of Panama, Panama - GS021
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1452
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Gulf of Panama, Panama
Coordinates	Lat. (^o)	8.129167	Long. (^o)	-79.69111	Alt. (m)		Depth (m)	1.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089012	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2237_10319952	F089012	GAG	MHQLVGPYEIEMELDEDYSERNIDGARLISKFKWESNEDGSYKLEIDNKLTVDKRAKNTIYIQLPLEYKYSDKSVWSERRKQIMKKFKEDKDPVHEGAIHLVQTEEEKTIVSLYDISFHDEYVDEGNVNDEYEDKEHLQKTYGTPKLFRCVRCG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.