Scaffold GOS2235_1006098

Overview

Basic Information

• Taxon OID: 3300001954
• Scaffold ID: GOS2235_1006098
• Source Dataset Name: Marine microbial communities from Colon, Panama - GS019
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1785
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Colon, Panama
• Coordinates
  • Lat. (^o): 10.716389
  • Long. (^o): -80.25445
  • Depth (m): 1.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065103	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2235_10060984	F065103	N/A	NHKYNGNIYESLDNSSVMFLMENSQVKIAETVNDSSRFFNTEKQCLNSLTNKMVDGDMMIEFFGGAFVTGGSVFQKIKQCMAIDLEEKQLKRFLREMK*