| Basic Information | |
|---|---|
| Taxon OID | 3300001953 Open in IMG/M |
| Scaffold ID | GOS2231_1043593 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Key West, Florida, USA - GS015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1589 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Key West, Florida, USA | |||||||
| Coordinates | Lat. (o) | 24.488333 | Long. (o) | -83.07 | Alt. (m) | Depth (m) | 1.7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024331 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2231_10435935 | F024331 | N/A | MYNTHLKPLYMLIKVEVDRDIVYNQDKAEAYAENHCNSLEYALCDWYYPDEPQYPYIAK* |
| ⦗Top⦘ |