Scaffold GOS2231_1042314

Overview

Basic Information

• Taxon OID: 3300001953
• Scaffold ID: GOS2231_1042314
• Source Dataset Name: Marine microbial communities from Key West, Florida, USA - GS015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2104
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Key West, Florida, USA
• Coordinates
  • Lat. (^o): 24.488333
  • Long. (^o): -83.07
  • Depth (m): 1.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035799	Metagenome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2231_10423144	F035799	N/A	VFKTINKSITSILLFMISFIKSGFLLFSDQDADLFQVAALMDMRQLLDMVLGREVG*