Scaffold GOS2231_1016872

Overview

Basic Information

• Taxon OID: 3300001953
• Scaffold ID: GOS2231_1016872
• Source Dataset Name: Marine microbial communities from Key West, Florida, USA - GS015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1461
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Key West, Florida, USA
• Coordinates
  • Lat. (^o): 24.488333
  • Long. (^o): -83.07
  • Depth (m): 1.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002883	Metagenome / Metatranscriptome	523	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2231_10168724	F002883	N/A	MSTLHHEDLLLSIFDEVCENFPYLDEEKQIEIANKRFEELCQ*