Scaffold GOS2224_1020504

Overview

Basic Information

• Taxon OID: 3300001952
• Scaffold ID: GOS2224_1020504
• Source Dataset Name: Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1796
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Newport Harbor, Rhode Island, USA
• Coordinates
  • Lat. (^o): 41.485832
  • Long. (^o): -71.35111
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067201	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2224_10205041	F067201	N/A	MDKVPVVEDKAFTLYLEEYNNLLFIHCDVYKWLKSTRKKMEIHLDFLLKKYNRPIFAAHIDNDNKHRKFLDMYGFKYVGVIKDFEGNDRTIFVKGVNNNG*