Scaffold GOS2249_1053032

Overview

Basic Information

• Taxon OID: 3300001951
• Scaffold ID: GOS2249_1053032
• Source Dataset Name: Marine microbial communities from North Seamore Island, Equador - GS034
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1584
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: North Seamore Island, Equador
• Coordinates
  • Lat. (^o): -0.38305557
  • Long. (^o): -90.279724
  • Depth (m): 2.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027997	Metagenome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2249_10530323	F027997	N/A	LRLLDEVDNMIMIIDQSVEQGRPIDPAEARNRFRLIRNKLAVITDRVSGS*