| Basic Information | |
|---|---|
| Taxon OID | 3300001949 Open in IMG/M |
| Scaffold ID | GOS2238_1036188 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Panama City, Panama - GS022 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1467 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama City, Panama | |||||||
| Coordinates | Lat. (o) | 6.492778 | Long. (o) | -82.90389 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027532 | Metagenome | 194 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2238_10361882 | F027532 | N/A | MALSNTPVLYKVKKKRKIIKAIIASAVIMFFFLVFLSGVIIIFYLSEKGQKLKINKVSNIQILFWPFSD* |
| ⦗Top⦘ |