Scaffold GOS2238_1004695

Overview

Basic Information

• Taxon OID: 3300001949
• Scaffold ID: GOS2238_1004695
• Source Dataset Name: Marine microbial communities from Panama City, Panama - GS022
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1497
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Panama City, Panama
• Coordinates
  • Lat. (^o): 6.492778
  • Long. (^o): -82.90389
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004764	Metagenome / Metatranscriptome	424	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2238_10046952	F004764	GGAGG	MNYANFGLEKNVEILSAHHVERFTQLRENEQYQDADAVAQEYVCKGEVEDDNYQWLYVNYQFKEAN*