Scaffold GOS2218_1029592

Overview

Basic Information

• Taxon OID: 3300001947
• Scaffold ID: GOS2218_1029592
• Source Dataset Name: Marine microbial communities from the Gulf of Maine, Canada - GS002
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1587
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Gulf of Maine, Canada
• Coordinates
  • Lat. (^o): 42.503056
  • Long. (^o): -67.24
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022757	Metagenome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2218_10295921	F022757	GGAG	MAKKNQPLDREYFKRRANPNVKKGPQLTKCCGQDKDYDSLNVRNSEDWKLIENYIEEHLREYTKHISVTPVSCEKCGILLEYSTD