Scaffold GOS2218_1020702

Overview

Basic Information

• Taxon OID: 3300001947
• Scaffold ID: GOS2218_1020702
• Source Dataset Name: Marine microbial communities from the Gulf of Maine, Canada - GS002
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1498
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Gulf of Maine, Canada
• Coordinates
  • Lat. (^o): 42.503056
  • Long. (^o): -67.24
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020459	Metagenome	224	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2218_10207022	F020459	AGG	MSETAEPKKTSVADDEAKRWRKGKGAAHRVEERAQAAYSYILEGGTRIQIAQKIVSRFNISLRTAHDDYKRAMQLLREEQQGTREELLNQLQALRLATVQRALKRGHYQTVATLLGDMGRVIGEAAPEQLALQVPTLDITIENKGQ*