Scaffold GOS2241_1011388

Overview

Basic Information

• Taxon OID: 3300001945
• Scaffold ID: GOS2241_1011388
• Source Dataset Name: Marine microbial communities from Galapagos, Equador - GS026
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1390
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Galapagos, Equador
• Coordinates
  • Lat. (^o): 1.2641667
  • Long. (^o): -90.295
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008152	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2241_10113883	F008152	GGAG	MKEYDGLLWYKETIERMTWDEIQEEMSKRIKNGSWNNYVKTLGKPPHVIKHDYLIREMNK