| Basic Information | |
|---|---|
| Taxon OID | 3300001944 Open in IMG/M |
| Scaffold ID | GOS2251_1029913 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1915 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cabo Marshall, Isabella Island, Equador | |||||||
| Coordinates | Lat. (o) | -0.02083333 | Long. (o) | -91.19778 | Alt. (m) | Depth (m) | 2.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069452 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2251_10299132 | F069452 | N/A | MHPMFEVGDMVRFKASGIVRSRYNPNKRFGIVVSVRRDVFRSYNSSMEDLVEVLWMPWSQTERLMEFYLEHASGEE* |
| ⦗Top⦘ |