Scaffold GOS2251_1001438

Overview

Basic Information

• Taxon OID: 3300001944
• Scaffold ID: GOS2251_1001438
• Source Dataset Name: Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1605
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium TMED271 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Cabo Marshall, Isabella Island, Equador
• Coordinates
  • Lat. (^o): -0.02083333
  • Long. (^o): -91.19778
  • Depth (m): 2.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084330	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2251_10014384	F084330	AGAAGG	MANRLDTFLKNIFGKTFYSNIWIATSLGLVSQVIGFTKYDGYFDLYWIIMKDGYLYFNLYPSLDELSFVLFIRVFLAIFVFLTIRDKLKGKNDLD*