Basic Information | |
---|---|
Taxon OID | 3300001942 Open in IMG/M |
Scaffold ID | GOS2262_1030301 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Polynesia - GS047 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1840 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Polynesia | |||||||
Coordinates | Lat. (o) | -10.131389 | Long. (o) | -135.44945 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019256 | Metagenome / Metatranscriptome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2262_10303012 | F019256 | AGTAG | MAETIEGDGSAAGSKASVDLTTFQQLLDKLEGSKKRQQRQKSIEGRRDVYAQGLASMMSNF* |
⦗Top⦘ |