Scaffold GOS2262_1026180

Overview

Basic Information

• Taxon OID: 3300001942
• Scaffold ID: GOS2262_1026180
• Source Dataset Name: Marine microbial communities from Polynesia - GS047
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1520
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Polynesia
• Coordinates
  • Lat. (^o): -10.131389
  • Long. (^o): -135.44945
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051985	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2262_10261803	F051985	GGAGG	MLKYFKVEDLIDSFHTDEKNKGRRYREFLYHCFMKFEKQMKKIKSKKLINKYITMRNNTL