Basic Information | |
---|---|
Taxon OID | 3300001942 Open in IMG/M |
Scaffold ID | GOS2262_1011815 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Polynesia - GS047 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1844 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Polynesia | |||||||
Coordinates | Lat. (o) | -10.131389 | Long. (o) | -135.44945 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089558 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2262_10118153 | F089558 | N/A | MGSLEDYNTKQGGISGQFASERFILNNKDAKAIFLKVAKEAQEKYISDTVAAQYLVDTFIQFQHLNYNTVRKYFKDYRDGRLK* |
⦗Top⦘ |