| Basic Information | |
|---|---|
| Taxon OID | 3300001942 Open in IMG/M |
| Scaffold ID | GOS2262_1000097 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Polynesia - GS047 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1434 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Polynesia | |||||||
| Coordinates | Lat. (o) | -10.131389 | Long. (o) | -135.44945 | Alt. (m) | Depth (m) | 30 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014026 | Metagenome / Metatranscriptome | 266 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2262_10000975 | F014026 | GGAG | MKKIKETYINTLVDSMSLEDLQQYVRNDMADFLQYCNEIGVIQNEFLIKINHTLDEQFYNKFVKQNKEMLL* |
| ⦗Top⦘ |