Scaffold GOS2222_1004498

Overview

Basic Information

• Taxon OID: 3300001940
• Scaffold ID: GOS2222_1004498
• Source Dataset Name: Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1764
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Bay of Fundy, Nova Scotia, Canada
• Coordinates
  • Lat. (^o): 45.111668
  • Long. (^o): -64.94666
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018155	Metagenome / Metatranscriptome	236	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2222_10044984	F018155	GGAG	MGQNSKAVAKRREELKNEKLDKQITYYYFQKGAGTHYREIQYQSGRVVRTDFDA*