Scaffold GOS2221_1008583

Overview

Basic Information

• Taxon OID: 3300001938
• Scaffold ID: GOS2221_1008583
• Source Dataset Name: Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5221
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Bedford Basin, Nova Scotia, Canada
• Coordinates
  • Lat. (^o): 44.690277
  • Long. (^o): -63.637222
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037174	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2221_10085831	F037174	N/A	MKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKT