| Basic Information | |
|---|---|
| Taxon OID | 3300001938 Open in IMG/M |
| Scaffold ID | GOS2221_1006009 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1677 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED175 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bedford Basin, Nova Scotia, Canada | |||||||
| Coordinates | Lat. (o) | 44.690277 | Long. (o) | -63.637222 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048243 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2221_10060091 | F048243 | AGGA | MTEDNIKIIKLSSGEEIICNVVHNTEKPYLSVIAPMKLNSYPKATRNGIEEALSLQRWIHFAETNTYDIPKSQIIVLTEASYGLSKFYEYCVNKSKLEDETVLSGAPTDMELDDMKLR |
| ⦗Top⦘ |