| Basic Information | |
|---|---|
| Taxon OID | 3300001937 Open in IMG/M |
| Scaffold ID | GOS2252_1019874 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Equatorial Pacific Ocean - GS037 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1133 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Equatorial Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -1.9738889 | Long. (o) | -95.014725 | Alt. (m) | Depth (m) | 1.8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097265 | Metagenome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2252_10198741 | F097265 | GAGG | MLVPEIIKKINSDKVVVKYGNDYVLLSHVPARENGYPQYPETLGFLCNEDGEVKNWTEVAGGSYMEISDVITEISRFGITKRGAYQ* |
| ⦗Top⦘ |