Scaffold GOS2220_1007211

Overview

Basic Information

• Taxon OID: 3300001936
• Scaffold ID: GOS2220_1007211
• Source Dataset Name: Marine microbial communities from Halifax, Nova Scotia, Canada - GS004
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1587
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Halifax, Nova Scotia, Canada
• Coordinates
  • Lat. (^o): 44.137222
  • Long. (^o): -63.644444
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102089	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2220_10072112	F102089	GGGGG	MKPRLFLVRWKDACGGSRSGWRSIEEMKETKEASVMSVGVILHQDKQRILLCPHVLLDDNGDVEEGDAEIAIPMDWVMSVEEWDTHG*