Scaffold GOS2223_1007837

Overview

Basic Information

• Taxon OID: 3300001935
• Scaffold ID: GOS2223_1007837
• Source Dataset Name: Marine microbial communities from Northern Gulf of Maine, Canada - GS007
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1279
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Northern Gulf of Maine, Canada
• Coordinates
  • Lat. (^o): 43.63222
  • Long. (^o): -66.84722
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036432	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2223_10078372	F036432	GAG	MIKDRRIDPKIDEDTQRFFNRIVYTLIVLNLLIGIPTIYYEYFHDHTPNVIRDISTILTNEV*