NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2267_103584

Scaffold GOS2267_103584


Overview

Basic Information
Taxon OID3300001934 Open in IMG/M
Scaffold IDGOS2267_103584 Open in IMG/M
Source Dataset NameEstuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2910
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Monodnaviria → Shotokuvirae → Cressdnaviricota → unclassified Cressdnaviricota → CRESS viruses → CRESS virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameChesapeake Bay, Maryland, USA
CoordinatesLat. (o)38.133335Long. (o)-76.38333Alt. (m)Depth (m)2.07
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083429Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
GOS2267_1035842F083429AGGAGMMARKTQTKTTYGKAFKKKGSSGKFRKGTLVQYKYQNGRRVGTVKARRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.