Basic Information | |
---|---|
Taxon OID | 3300001934 Open in IMG/M |
Scaffold ID | GOS2267_102716 Open in IMG/M |
Source Dataset Name | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1272 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chesapeake Bay, Maryland, USA | |||||||
Coordinates | Lat. (o) | 38.133335 | Long. (o) | -76.38333 | Alt. (m) | Depth (m) | 2.07 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047635 | Metagenome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2267_1027162 | F047635 | N/A | EWVIANGIFTPRRCETEDEDLRKLFDDIDILYQTATSTVSFNLLNPINTIHHEGFFYVHPGLVLDMLIEKYQNVVLRNNYSKDIYTVQIYKF* |
⦗Top⦘ |