Scaffold GOS2267_102071

Overview

Basic Information

• Taxon OID: 3300001934
• Scaffold ID: GOS2267_102071
• Source Dataset Name: Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2722
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Chesapeake Bay, Maryland, USA
• Coordinates
  • Lat. (^o): 38.133335
  • Long. (^o): -76.38333
  • Depth (m): 2.07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040396	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2267_1020711	F040396	N/A	WKLFASSSQSASGIFQGSGVYDPRAGAGKLSGKDKALAICEVCWILPDEPPERQDVALQPDGIVESSAYTSTSPA*