Scaffold GOS2267_100224

Overview

Basic Information

• Taxon OID: 3300001934
• Scaffold ID: GOS2267_100224
• Source Dataset Name: Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1870
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Chesapeake Bay, Maryland, USA
• Coordinates
  • Lat. (^o): 38.133335
  • Long. (^o): -76.38333
  • Depth (m): 2.07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007062	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2267_1002243	F007062	AGGAG	MIDEPRFKNIQKERDLLSVAHIKKLEEEIDMLRKQKIYLQSKLKEKNGESKT*