| Basic Information | |
|---|---|
| Taxon OID | 3300001934 Open in IMG/M |
| Scaffold ID | GOS2267_100209 Open in IMG/M |
| Source Dataset Name | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1796 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chesapeake Bay, Maryland, USA | |||||||
| Coordinates | Lat. (o) | 38.133335 | Long. (o) | -76.38333 | Alt. (m) | Depth (m) | 2.07 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056625 | Metagenome / Metatranscriptome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2267_1002091 | F056625 | N/A | MMIVNLSPLEIDFLLRELAANQGMIAPSASIPAWYRHSIQETLRDALLADRKQRWAVSDKRHQELLDAEKEGLVREYTRQAEANQSRLQGAYAQTGNEGGTDRESL* |
| ⦗Top⦘ |