NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24731J21663_1002385

Scaffold JGI24731J21663_1002385


Overview

Basic Information
Taxon OID3300001914 Open in IMG/M
Scaffold IDJGI24731J21663_1002385 Open in IMG/M
Source Dataset NameBioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11606
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (35.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Metamonada → Parabasalia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location
Location NameEspanola, New Mexico, United States
CoordinatesLat. (o)35.9918Long. (o)-106.0796Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065191Metagenome128Y

Sequences

Protein IDFamilyRBSSequence
JGI24731J21663_10023851F065191N/AMPEVVFQCQDKTKHVEKRFLLCLNKYLDEYSGQDRIVLSDSCDFGVFCHFIDFLVSGSIPSDRNDQIGVINLLREWESHFGIVDGFRFRLC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.