NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24158J21664_10076898

Scaffold JGI24158J21664_10076898


Overview

Basic Information
Taxon OID3300001913 Open in IMG/M
Scaffold IDJGI24158J21664_10076898 Open in IMG/M
Source Dataset NameEcteinascidia turbinata endosymbiont from Florida, USA - Sample 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2664
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata → Ecteinascidia Turbinata Symbiotic Microbial Communities From The Caribbean Mangrove

Source Dataset Sampling Location
Location NameKey West, Florida, United States
CoordinatesLat. (o)24.5512Long. (o)-81.8083Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090985Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
JGI24158J21664_100768984F090985N/ARHCPLTMKRHITKLLYVCVAVCKLLNSIACIGAGTARGGNSETRAFDAISISSVQKRGLFHVTAQALFRQGMDVVVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.