| Basic Information | |
|---|---|
| Taxon OID | 3300001867 Open in IMG/M |
| Scaffold ID | JGI12627J18819_10192174 Open in IMG/M |
| Source Dataset Name | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 825 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Davy Crockett National Forest, Groveton, Texas, USA | |||||||
| Coordinates | Lat. (o) | 31.11 | Long. (o) | -95.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067949 | Metagenome / Metatranscriptome | 125 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI12627J18819_101921742 | F067949 | N/A | MRGTVLNCRIVKILTLLMVIVPTPARSHPSFVHVPNLADARIRDILDEPDPDDTGDCLSLGELDIVFRTGNDGPPNVGVVLTDPRGRRIGFDPLIKHAWQALPVAQGDINCDDLDRTNTCRGIVQVCGPISGTYKLEVIALKTTAYSVSVLALSREVFDGNSLQSHFSKTGLNSLAIQNRSRQIVLLHYSRDPQENITAQLQQGHESLSRLSSSD* |
| ⦗Top⦘ |