Scaffold JGI12627J18819_10100819

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12627J18819_10100819

Scaffold JGI12627J18819_10100819

Overview

Basic Information
Taxon OID	3300001867 Open in IMG/M
Scaffold ID	JGI12627J18819_10100819 Open in IMG/M
Source Dataset Name	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1192
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	Davy Crockett National Forest, Groveton, Texas, USA
Coordinates	Lat. (^o)	31.11	Long. (^o)	-95.15	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032842	Metagenome	179	N

Sequences

Protein ID	Family	RBS	Sequence
JGI12627J18819_101008192	F032842	AGG	MRDSMMLSSNRDLLEAEQLQDLWCSLSLRHVSLEGGRCSCGREHVTLRLTDFEEDIGEYLYDDAARGQRQDINAFLRAHGRDAETGRWNIDRLVRLLASSEPELGLTAEIRAELVAKLRPIIESFDRLHV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.