| Basic Information | |
|---|---|
| Taxon OID | 3300001851 Open in IMG/M |
| Scaffold ID | RCM31_10089359 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 982 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Afu?, Para, Brazil | |||||||
| Coordinates | Lat. (o) | -0.156917 | Long. (o) | -50.62255 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000273 | Metagenome / Metatranscriptome | 1401 | Y |
| F003520 | Metagenome / Metatranscriptome | 481 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RCM31_100893592 | F003520 | AGG | MANNIAFQSCGKTSKASVTTSSQTMTVTPDGPCNQVCVANHQSPQGGQPVYFNISNQSNVTVTVPTGSGANASYCLVSVPGTIKVFTVPYQFSPSAPLYIAFIGEGSSECYFTPGEGL* |
| RCM31_100893594 | F000273 | AGG | MEESQNAKGALIEKVAFAILPILFTCVVYLMNALSVINNEVTILNNKISLVVTSDNKQAVNTGAELAREKLRQDLEHEIQKNRDDIQVNRQHIAVLEE |
| ⦗Top⦘ |