Scaffold RCM31_10013103

Overview

Basic Information

• Taxon OID: 3300001851
• Scaffold ID: RCM31_10013103
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8388
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Afu?, Para, Brazil
• Coordinates
  • Lat. (^o): -0.156917
  • Long. (^o): -50.62255

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032263	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM31_100131037	F032263	GGAGG	MATKAVWEKRRPKDLGEPKALTPNQKKAAKAFAKRTGTKYPSLVANMHGAKAKKGDW*