Scaffold RCM37_1250158

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RCM37_1250158

Scaffold RCM37_1250158

Overview

Basic Information
Taxon OID	3300001850 Open in IMG/M
Scaffold ID	RCM37_1250158 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	564
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Ábidos, Para, Brazil
Coordinates	Lat. (^o)	-1.919017	Long. (^o)	-55.525717	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006181	Metagenome / Metatranscriptome	379	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM37_12501582	F006181	N/A	MKNLVHVIYPDEYVASFIVEGEYTAEDILERVFAQWNHGSGCECEQFINSKKRSLSVNDIVCVNGTYYQCASFGWNEVTSDYVNELEEAVSNHPRRSDGAWFALNDVMWVRNKAKNLAVI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.