Basic Information | |
---|---|
Taxon OID | 3300001850 Open in IMG/M |
Scaffold ID | RCM37_1020912 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 740 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ábidos, Para, Brazil | |||||||
Coordinates | Lat. (o) | -1.919017 | Long. (o) | -55.525717 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006060 | Metagenome / Metatranscriptome | 382 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
RCM37_10209121 | F006060 | AGGA | MLKFENIAKIGDVIRAYDFAPCAGRDDAFVEGIVEQANCNEPGYNCYKITVTADKFKKYETVASKKNRVGKIVFVPHQTSFME |
⦗Top⦘ |