| Basic Information | |
|---|---|
| Taxon OID | 3300001850 Open in IMG/M |
| Scaffold ID | RCM37_1003883 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5139 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (27.27%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ábidos, Para, Brazil | |||||||
| Coordinates | Lat. (o) | -1.919017 | Long. (o) | -55.525717 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014494 | Metagenome / Metatranscriptome | 262 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RCM37_10038832 | F014494 | N/A | MTTKHFECEECGAQGKIIVKGDDHRLEDIVFCPVCSADIYEEEEFDEDE* |
| ⦗Top⦘ |