Scaffold RCM26_1197359

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RCM26_1197359

Scaffold RCM26_1197359

Overview

Basic Information
Taxon OID	3300001849 Open in IMG/M
Scaffold ID	RCM26_1197359 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	591
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Afu?, Para, Brazil
Coordinates	Lat. (^o)	-0.083883	Long. (^o)	-51.051417	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054037	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
RCM26_11973591	F054037	N/A	KMSKDWKRDFPDGKLDIKSGVEGKMVIDVTTKDSSAASLASKIKDVAARNKVNVVTKDKPTLKAVKENEEDLMKKIKSSLTFQVTGGKKGKPGLKEALDKRIAIVFLKYKDKSFPMDYKPTSMFAKFVNDLEKSGAFNSEDEVSDFMSSEEFDNYANKFNVEIDYADYDPTLLTLAPKEPVSTQDMIPGRAPQDFIS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.