Scaffold RCM26_1055015

Overview

Basic Information

• Taxon OID: 3300001849
• Scaffold ID: RCM26_1055015
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 980
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Afu?, Para, Brazil
• Coordinates
  • Lat. (^o): -0.083883
  • Long. (^o): -51.051417

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000450	Metagenome / Metatranscriptome	1126	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM26_10550151	F000450	GAGG	VGDRANFGFVQPNGNTIVLYGHWAGAQMLGRLADAVIKARPRWSDPAYATRIAISQIIGDDWNMETGFGLHVNEISDNEHKIAIVDWVQQTFSLHEEDDYINTDNKVRGMKNEAIFTMDLSAFCEKYALDAMLVN*