Scaffold RCM47_1134190

Overview

Basic Information

• Taxon OID: 3300001848
• Scaffold ID: RCM47_1134190
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Santar?m, Para, Brazil
• Coordinates
  • Lat. (^o): -2.484383
  • Long. (^o): -55.0075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000324	Metagenome / Metatranscriptome	1299	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM47_11341901	F000324	N/A	HMMDAANTIAPKHSFTYDGAQINVYHADKGQGLPAHSHAYSHATMCCAGSCWVRNERGEHLVTKDTQPINLVAGEWHEIEAAEDGTVFVNIFAEGKY*