Scaffold RCM41_1128776

Overview

Basic Information

• Taxon OID: 3300001847
• Scaffold ID: RCM41_1128776
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1409
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Santar?m, Para, Brazil
• Coordinates
  • Lat. (^o): -2.484383
  • Long. (^o): -55.0075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043892	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM41_11287762	F043892	GGAG	MRLADLINSLFMYDALQPDLISVENCKPTDPRRYDERRKACVKYLRERNLYILDGHFTPTKAANTDITSVFNRARQQLGEKLIQVAK*