NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM41_1001905

Scaffold RCM41_1001905


Overview

Basic Information
Taxon OID3300001847 Open in IMG/M
Scaffold IDRCM41_1001905 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9789
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (81.25%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameSantar?m, Para, Brazil
CoordinatesLat. (o)-2.484383Long. (o)-55.0075Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037700Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
RCM41_10019051F037700N/AETYGDTTEYYPQEKRLFWWYNIFAFDVYFDGGYSTLEEAQKHLCVYCRGTMVEYLDFDPNEDCK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.