| Basic Information | |
|---|---|
| Taxon OID | 3300001847 Open in IMG/M |
| Scaffold ID | RCM41_1001874 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10150 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (46.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santar?m, Para, Brazil | |||||||
| Coordinates | Lat. (o) | -2.484383 | Long. (o) | -55.0075 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046245 | Metagenome / Metatranscriptome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RCM41_10018745 | F046245 | N/A | MEYFVTFFAVFVTDLLYVYFVKAIQNNRPWRAAWWSMVVTFTTSVAIINYTTNHWALITALMGAFFGTWVGMKIKQKESNVTNN* |
| ⦗Top⦘ |