Scaffold ACM22_1006971

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACM22_1006971

Scaffold ACM22_1006971

Overview

Basic Information
Taxon OID	3300001846 Open in IMG/M
Scaffold ID	ACM22_1006971 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6452
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (64.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon River plume to Atlantic Ocean
Coordinates	Lat. (^o)	11.3123	Long. (^o)	-56.4267	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019653	Metagenome / Metatranscriptome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM22_10069715	F019653	AGGA	MTSLVQNFVFSPLSGFWSAIERYTQIAGYSRAAAELARAGYIEESKKCMMQIKRIQDGDTN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.