Scaffold shallow_1012955

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold shallow_1012955

Scaffold shallow_1012955

Overview

Basic Information
Taxon OID	3300001845 Open in IMG/M
Scaffold ID	shallow_1012955 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Sites - lt1kb
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	899
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location
Location Name	Mid Cayman Rise, Cayman Islands, UK
Coordinates	Lat. (^o)	18.35	Long. (^o)	-81.85	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080151	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
shallow_10129551	F080151	N/A	MSESYYMKDEDGLFRMFDVSHDGLEDAIEAANEAGVDVLRDRDGETETVWSFEDAGSDEPWDGFNSDAEADADALASA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.